Scaffold Ga0268247_10447984

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0268247_10447984

Scaffold Ga0268247_10447984

Overview

Basic Information
Taxon OID	3300030498 Open in IMG/M
Scaffold ID	Ga0268247_10447984 Open in IMG/M
Source Dataset Name	Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	585
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location Name	Guanajuato, Mexico
Coordinates	Lat. (^o)	21.0936	Long. (^o)	-100.2988	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085044	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0268247_104479841	F085044	N/A	KQIVLQKSLDKHGDSDNDTVSSAASSSPPKHEDLHDSHDPYDL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.