Scaffold Ga0247639_1106534

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247639_1106534

Scaffold Ga0247639_1106534

Overview

Basic Information
Taxon OID	3300030585 Open in IMG/M
Scaffold ID	Ga0247639_1106534 Open in IMG/M
Source Dataset Name	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	732
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	France: Rollainville
Coordinates	Lat. (^o)	48.3625	Long. (^o)	5.7397	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001542	Metagenome / Metatranscriptome	673	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247639_11065341	F001542	N/A	DPLNRRISFIAAFFAFVGVILGVVALATNYWTIAQFVTPGTALQTPNGTLLTNENVDWTWNGLFYQCTTRENVPCLSRFWSTTFIICLLGLIFLLVGGIFICWDIFQITDRRFVIPLLIFVASVLLTAGVVDYGSWSLLNSHSSRTMIAAIVFAYSALPISAFIAGRYSAFDRFVVNGHVTNGQKYVQTSTNGN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.