NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316363_10014701

Scaffold Ga0316363_10014701


Overview

Basic Information
Taxon OID3300030659 Open in IMG/M
Scaffold IDGa0316363_10014701 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4469
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010268Metagenome / Metatranscriptome306Y
F020407Metagenome / Metatranscriptome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0316363_100147012F020407AGGAGGMVKQRFLTHFKPWLFAVIKVVGLIVGYQLFDKARTYLQYAPLNSVDVLLGAVVALLMAGLLCGLWSWGEWCWFKLQRLRGFCAELKRPFRNHWGPKAVRTSQPVTRNMA
Ga0316363_100147013F010268AGGAMIAAPADERTGQLTSRSTGRGTRRVRPAAEEENVLGARFFLSKPGANGSSPELGRELPNEGEAKVEALKLGVTYYSVQEWRPVPDFGGKNPELKREAITRKGTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.