NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310039_10140425

Scaffold Ga0310039_10140425


Overview

Basic Information
Taxon OID3300030706 Open in IMG/M
Scaffold IDGa0310039_10140425 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)983
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024360Metagenome / Metatranscriptome206N

Sequences

Protein IDFamilyRBSSequence
Ga0310039_101404252F024360N/ATFFWSVGAWVLVLALGTSAAGQDWPSRHYSGVINDYPLSANPTAGPWELRGPWSLSLRPLGRADFSAALTMEFSDLGSGSGFSTDSRHQHTHHITMKSATLVWNPPQTDCPTGITPFPTYTWVLEVNGMADVTANGGSPFTGQVPLQVCLGGGPNLEISNITLVFTNLSTGPSQATNHFGPQPIHGVVRLPKEPQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.