NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310038_10020856

Scaffold Ga0310038_10020856


Overview

Basic Information
Taxon OID3300030707 Open in IMG/M
Scaffold IDGa0310038_10020856 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4086
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001772Metagenome / Metatranscriptome637Y
F006357Metagenome / Metatranscriptome375Y
F022277Metagenome / Metatranscriptome215Y

Sequences

Protein IDFamilyRBSSequence
Ga0310038_100208561F006357N/AISSGKLTPTVVYQLGRAINSSNILLSPDETLLYVSNNQSGTVTAAFFDKSTGKLSKGCVSRPLRGFVADWSYLASLAFEQTTGTGGIVYVAEYGAPSSIGMVNVKSASGKCTLTESSHSPVADTNSPGLLSIGAFPPRPF
Ga0310038_100208563F001772GGAGGMRKSSVFVLAGALLFVAGYLIGNRNATVAYAGSPTQGTVPKSYGRLVTAIADQIGTGLVFEDSGGVIRFVSITGMKEGELARYDQTPTRGGIPKSYGRLVTAVVNSEGTGLIFEDSEGVIRFVTIAGKKEGELTRN
Ga0310038_100208566F022277N/AMAFKLHSPRCLLSSVIGHRTGAPLISWTQDAVVTLPQTLPEPKPKRKHSLLPVLIVLFLVSYGLMSLLAIEQDRTIASQRWLITSLLGDSTELSSLKGKMIQKKYAEAQAQAKAGSRSQPKSPSAQNPSVQTPMTQSPITQDTPESGAPRHHNAGKLRKAVPQKPPLGIADIVDGRRIVKTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.