NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302310_10151533

Scaffold Ga0302310_10151533


Overview

Basic Information
Taxon OID3300030737 Open in IMG/M
Scaffold IDGa0302310_10151533 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1392
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007895Metagenome / Metatranscriptome343Y
F033133Metagenome / Metatranscriptome178Y

Sequences

Protein IDFamilyRBSSequence
Ga0302310_101515331F033133N/AELKAARDYEQIRRVLEAAFGSNDFDGFEVRFKLFPGEPYPAADPGLQPRRAEASLHWGKSKGSRSLEGLAVWTLSLDLVNSSNRHRGALVVHRLYSQRNLQIDINLLTTGFPVALADALDRTLQHGVQVIPHPGHDDQRFVAAQAG
Ga0302310_101515332F007895GAGGMFSKTVYGTTFKDVHFVPLQSATFCIQCELIGTNSRPYCLACGNTSLLCLSRVLGGSLRNQQTAHLITDSELDRLVRDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.