NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073975_1004493

Scaffold Ga0073975_1004493


Overview

Basic Information
Taxon OID3300031007 Open in IMG/M
Scaffold IDGa0073975_1004493 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)581
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067799Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0073975_10044931F067799N/AMAIVFPVMVAASVWKAMVISLVGTFWQFFIWSYILVDIVFDTFVRLFIGTICKPCAWLAIWAFKLPTFPIIIFGWAFRIMTETMGALVSGWMLFFGGSGCYLRWGHDCWFSKRFHERSYWQIADLTIWLRNPADFFVKDPEMSFSDSVHAFFAVPKFEDFDTEMAKLIGQNRRQQLFDSCPINRNTIADAKST

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.