Basic Information | |
---|---|
Taxon OID | 3300031022 Open in IMG/M |
Scaffold ID | Ga0138301_1546174 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 555 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South-western Pyrenees, Aspurz, Spain | |||||||
Coordinates | Lat. (o) | 42.0 | Long. (o) | 1.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002447 | Metagenome / Metatranscriptome | 558 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138301_15461742 | F002447 | N/A | VLRIIETPAGERHLRYFVSPQDFGLNEINALSKQVQAKLLEAFGLAADTKFLKGKAVGSA |
⦗Top⦘ |