Scaffold Ga0265749_101362

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0265749_101362

Scaffold Ga0265749_101362

Overview

Basic Information
Taxon OID	3300031042 Open in IMG/M
Scaffold ID	Ga0265749_101362 Open in IMG/M
Source Dataset Name	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	756
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Norway: Oslo
Coordinates	Lat. (^o)	59.997	Long. (^o)	10.7902	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080954	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265749_1013621	F080954	N/A	SASERTFPATQEDEGPEEVGDLFRGASRGIQDSKEIGRPIPGAAGDAKFGSSRSFVAG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.