NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318490_1320745

Scaffold Ga0318490_1320745


Overview

Basic Information
Taxon OID3300031116 Open in IMG/M
Scaffold IDGa0318490_1320745 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil fungal communities from Los Alamos, New Mexico, United States - Jemez Pines Pi 5A (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)692
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales → Araceae → Pothoideae → Potheae → Anthurium → Anthurium amnicola(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Forest Soil Microbial Communities From France, Sweden And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameUSA: New Mexico
CoordinatesLat. (o)35.8911Long. (o)-106.2978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044272Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0318490_13207451F044272N/AAIRFTMASQKSGSRNKAKTGNKSGAGVFDKNAAIRMVEVPIPGPGVYQFEDGLSSADRVWVEWCPSAAIEGKRRRAFLSKNGISDPSEILTDGGRQMPRKGLSCSLDSRHAVVFGPGKFKIWVAHERASNTSQVTQRELPSQLLQLVAPDARYLSPRSSTSTSAPVARR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.