NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170823_12870636

Scaffold Ga0170823_12870636


Overview

Basic Information
Taxon OID3300031128 Open in IMG/M
Scaffold IDGa0170823_12870636 Open in IMG/M
Source Dataset NameOak Summer Coassembly Site 11 - Champenoux / Amance forest
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)722
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Champenoux
CoordinatesLat. (o)48.7184Long. (o)6.3471Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004042Metagenome / Metatranscriptome456Y
F036398Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0170823_128706361F000092GAGVKQHLGRQSGVQTVEVSLIDGKVQVTPKEDGQIDPSQLLKATYDSGVTPAEMDVTVRGRIVKDPLGGIALQFEPNRSFAIIPNEMSKGLEPLAGSQRMTTVKGELYKKSAGKKKADTSIPLKLLILEIQKKE
Ga0170823_128706362F004042AGGAGMEMRKLALLILLGSALAPVSLAQIKHVEMRVEGMT
Ga0170823_128706363F036398N/AVLLAGITTYAGVRPGMHVWVGVDWGVAHSTGAMFMPVRRHISFGVTQQFRFHVLGN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.