NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308021_10014664

Scaffold Ga0308021_10014664


Overview

Basic Information
Taxon OID3300031141 Open in IMG/M
Scaffold IDGa0308021_10014664 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #351
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3418
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012639Metagenome / Metatranscriptome279Y
F029595Metagenome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0308021_100146645F029595N/AMNCFESPSGRKNHMMWHKRQSIRDFRSQKPMFTQLMQASKQCMNAHPELKCSSSSCVKKAIACETIHPATMSQFNNFTFHTHPHNIPYPSPQDIETTKNTLKKDYLLIGVVPQNKTYVYSIKDNFKKPIATI
Ga0308021_100146648F012639AGGAGMSSNNSGLVLNCTATYAAAAPVATVLSVTMQTSPTVTGVTELQVPLTENWIATDVYILAAGGAGSGTVINPVITMDKNRGRTLVQTPPLSAMLITSNTRPRFSPQPVGFEGGSIIRMFATSTVLNAGAISNIQFSVAISIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.