NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307495_10075645

Scaffold Ga0307495_10075645


Overview

Basic Information
Taxon OID3300031199 Open in IMG/M
Scaffold IDGa0307495_10075645 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)749
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)44.5508Long. (o)-123.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051783Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0307495_100756452F051783N/AMPVVRLHRAPAAPATPVYEDDLGRALRLAQEGWYWQGEVEDLLLAIRDGGDLAELSRTGGPIISRFEAMRVELRAIGHPALRADVIAMDEVFANHAMVLTCALDLLAVSWRSERLREEQGRLGGVGAQGVRLAELTTRLKRLAEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.