Scaffold Ga0307974_1001798

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307974_1001798

Scaffold Ga0307974_1001798

Overview

Basic Information
Taxon OID	3300031211 Open in IMG/M
Scaffold ID	Ga0307974_1001798 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Organic Lake, Antarctica - #784
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14997
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Organic Lake
Coordinates	Lat. (^o)	-68.4563	Long. (^o)	78.1898	Alt. (m)		Depth (m)	3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059522	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307974_10017982	F059522	N/A	VKAHSGIAGNECVDAIAKHSALHDGGHDMHFQPPAPDGNAYTHLYWLAAKDTDENPSGRGTTPPRLRALSDLKAKLKTEMCKSHRLAGSAKTNTGYYSY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.