NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170824_103940713

Scaffold Ga0170824_103940713


Overview

Basic Information
Taxon OID3300031231 Open in IMG/M
Scaffold IDGa0170824_103940713 Open in IMG/M
Source Dataset NameCoassembly Site 11 (all samples) - Champenoux / Amance forest
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6812
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Mazerulles, Grand Est.
CoordinatesLat. (o)48.7585Long. (o)6.3578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007495Metagenome / Metatranscriptome350Y
F051338Metagenome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0170824_10394071310F007495N/AAEQAATLKRLAEAAYELEAFQPSLTRAEADLRISILAAKLKLLDGPPHTL
Ga0170824_1039407132F051338GGAGMRACLFVTLCLVARGLTGCTLVATQQAAKQATSCLQDVRSSPEGQIVYAKLWASDASDTAAKLSDPDPLTPTERDALVQVHNNIISCRQMIISDDSRSAAWERPYWLDYFQRSDAIFNKLASRELPVGLANKLTIESNGKFQADVSRGHADAVPVDEAQQQQSAEALMQSSAQITTSQPQSRLTATNCRWVANTLSCIISDQH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.