NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302325_10237706

Scaffold Ga0302325_10237706


Overview

Basic Information
Taxon OID3300031234 Open in IMG/M
Scaffold IDGa0302325_10237706 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3060
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002897Metagenome / Metatranscriptome522Y
F024358Metagenome / Metatranscriptome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0302325_102377061F024358GAGMAKDEKYSKVEQQWITEIRLRLAQRRGKKPATKSGQIRALWPEIRTAIADGQSLASIRQWLEEEGGVIVTVQSLGSYLTRIRRKEKATAATPTPPLAQPLAEAKLPSAPSSRENFQESAKKKHGFEYPPGPPDESKLI
Ga0302325_102377062F002897GGAGGMPRRTIRLNADIDERLQSTVKLKGYANPSAFLRAAIDHELSGREDTMIGAEERLAASMEQMRREIFRLGRAQQALFAFVDSLAKVLLTCVPEPGGEAMEAAVAKARGRHTRLLKTAGQAMVGDSHLVMQDLLNHGEG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.