NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308395_1001355

Scaffold Ga0308395_1001355


Overview

Basic Information
Taxon OID3300031245 Open in IMG/M
Scaffold IDGa0308395_1001355 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16145
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (73.68%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033055Metagenome / Metatranscriptome178Y
F050402Metagenome / Metatranscriptome145Y
F078761Metagenome / Metatranscriptome116N
F092114Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0308395_100135512F078761GGAVPKQNLSGYTEREECKLVPFVFALTRSELLTAHILRMDVREITALLKKPHIKREVDGYLLDIDTRIRQNWMALLGLLQSTMVVNLLELMRASNHDVRLQAIQIAAELISKYTDTGVAPELVEALQPAE
Ga0308395_10013552F092114GGAGMRELVSITRHKMEQLLGDNPPKRDTWLLKCRRLREIVSNLPANQIITTSIPEGHSNMLLINITIKAYAMMQLIRGTVIDFGDDTELFQPKFGEFLSSNELALRDAIMQRLVVGLGAVCVVGDKQHGWRLQSVSPTDLWWDCTTGDVMQPKWIAREYRDGDGTRYREVWYADVYHRYKVDSTDVETFTNPYGVIPIVLFPAHHIPDTVYPIGDVELACPQQFILDEIRRTYLNMARRGAGFYAVKRSSIDESELSRLQNPEEVYILVNEQDAILPIPTPAPNPEWQALEALAKQDMDALLGVSEYVRGVLPTGRAKFATEVVAAVAGQTVRIQSEWYNTKIALERLAKVYYKLHNPMGTAIPRALEDSITSANELLQTNMVGGNNSWNISVGQSV
Ga0308395_10013554F033055GGAGMVYPNEVVANDNWDTNTGIDILLALGENDGLYVYNTAPINLLHLGMPSEVVNCEVRVQGTGSLFTPQLLLNFYRGGILIDSISVPTTNDWVVHTLTVDRWDSVELLVGIGGTVAVDFLRAEPYGGLPTKRTLTGVGI
Ga0308395_10013556F050402N/AMFSQLPTTRKGTIAERYVRDVLAGMGWHIYAYATDRPHPLDMIAITPDGRLVGVEVKCKCARIYYPDTGIDRNDYYAYHNLQSQLNLPVLLLFVDNHTQTVYGNYLNTLSQPITIVDNKRTLEYPMITEQYVYFPLQLMEHHANIPPAIVAQLNTRTHSKYHHPLPHATDVDDGGV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.