NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302187_10143901

Scaffold Ga0302187_10143901


Overview

Basic Information
Taxon OID3300031259 Open in IMG/M
Scaffold IDGa0302187_10143901 Open in IMG/M
Source Dataset NamePeat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1298
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0477Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002897Metagenome / Metatranscriptome522Y

Sequences

Protein IDFamilyRBSSequence
Ga0302187_101439011F002897N/ALRVILSHIASAVTYISEGSFRMAQRAIRFSDTTDKGIQEATRKRGFSSPTAFIRHSVEQELSVRREELVGAEERLAATIEQVRRDIFRLGRAQQALFAFLDSLAKVVLTCVPEPGGEAMEAAIARARGRHTRLLKNAGQAMVGDSKLAMQDLVDDGER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.