NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272433_10007467

Scaffold Ga0272433_10007467


Overview

Basic Information
Taxon OID3300031450 Open in IMG/M
Scaffold IDGa0272433_10007467 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12873
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (7.69%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Rutstroemiaceae → Rutstroemia → unclassified Rutstroemia → Rutstroemia sp. NJR-2017a WRK4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-77.87Long. (o)160.75Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050043Metagenome145Y
F104135Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0272433_1000746711F104135N/AMNXDINMTQQYANALQRSDQMIQMFATHLSTLKHQLSLYSDEHKXAHLFIKLRSELHVIITNLQLISITXNALIDLVAXLKTNLRKEHILLSKXSXDENFHDQDKVNKKIHSKXKKSHQSIRLNSSSKKSSYASSHYSKNLFNITCYMCNQKNHYFTDCKDEKIKNKSKESDVNXVFIDSMSYVNHFKILKKDKLLMNALNHXEKNKKFSS
Ga0272433_100074676F050043N/AMIKIQSXLKKNEVEENKKLRKTERAINKSTIIIHSCLCFIVSTTSFTXKINNAYVLSTHHHDCHLHQLHITYTIYNVIYTHYNXRXIVIQLKVFLFLIFSQKFQDFYXKLLKXINECTSLFIRVNKNINYXDXK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.