NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272426_1021701

Scaffold Ga0272426_1021701


Overview

Basic Information
Taxon OID3300031451 Open in IMG/M
Scaffold IDGa0272426_1021701 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nord
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3503
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-77.57Long. (o)161.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F102177Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0272426_10217012F102177AGGAGMTQAARDERDIAPYDLTFAGGPEDQSLAIDAPSLDSGPDQGDREVTYYTREPDGYGPDDYRWQPITDPAEIATIEDALAQGIDPPYEVWVDQAPAALAPGDLAPSEEGPTVYAWEQIGPAVGEGQLYEVTDPIIVTAYTEAHPAPSGIEIANPADYYEAASAPPRSRPPRWTSTAT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.