NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272422_1188208

Scaffold Ga0272422_1188208


Overview

Basic Information
Taxon OID3300031452 Open in IMG/M
Scaffold IDGa0272422_1188208 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)615
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-74.2Long. (o)162.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074204Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0272422_11882081F074204N/ADSHMIVFCILRQAQSKVFTFALIDSEVFAYVFMNKFFTQQHHLLLHQLTHFCRLQEFNDQVALIDDIIHVVEITMILDEYIKRLFFYVIELSQYLIIMSLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.