NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272448_1003725

Scaffold Ga0272448_1003725


Overview

Basic Information
Taxon OID3300031463 Open in IMG/M
Scaffold IDGa0272448_1003725 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17923
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5676Long. (o)-110.8075Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022018Metagenome / Metatranscriptome216Y
F082274Metagenome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0272448_100372527F022018AGGMAEVEDVVGAVMGSYGIYLSQVSETPWADAMLSIEYLEDFEDLNDRELIGTLATWAGVSYNVFKGIWEGLSDKEKEEALGEIEYRIAVLGFENLLKGIAADFYVMENRDVREKIIDTAKKYVSGKIDFYDLAEELENILWPTEKDKEENEQAVRYFWDGIGLTDYIEEDKVKEMVKRYLIEELEAVGRTPDLGKPGS
Ga0272448_100372529F082274AGGMSEAVSEEMTKQRLFSDFFVRYHPDFKASDFAAAAGPWQIVLRLRDGLINMPMSELKDKLEDYLEAAYNLGEVSGFAEALALAYDLNLAKDYLERPEVLSKLQRLAFELYWLSLRLEKMKLRRNESLAQKTAKLSYAAYRLIERALKAAKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.