NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170819_12647522

Scaffold Ga0170819_12647522


Overview

Basic Information
Taxon OID3300031469 Open in IMG/M
Scaffold IDGa0170819_12647522 Open in IMG/M
Source Dataset NameFir Spring Coassembly Site 11 - Champenoux / Amance forest
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Champenoux
CoordinatesLat. (o)48.7585Long. (o)6.3578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006591Metagenome / Metatranscriptome369Y
F031504Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0170819_126475221F031504AGGAGMPRAFTTRKWELAARGRDYQLIPTFPRLPGIIPEDPAGGPPLARQPLRKPSVLSKNP
Ga0170819_126475222F006591N/AGRLLDASPRGNAEFSVSWQDRRQDCSRRLLGEAFQRGSHGPCRGNVLHKVMRPLRHGLVTAVRQVGPRELPPERWPEGTGLASYPPSDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.