Scaffold Ga0170818_113222667

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170818_113222667

Scaffold Ga0170818_113222667

Overview

Basic Information
Taxon OID	3300031474 Open in IMG/M
Scaffold ID	Ga0170818_113222667 Open in IMG/M
Source Dataset Name	Fir Coassembly Site 11 - Champenoux / Amance forest
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1013
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	France: Mazerulles, Grand Est.
Coordinates	Lat. (^o)	48.7585	Long. (^o)	6.3578	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055573	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170818_1132226673	F055573	GAG	MPGKGRQHQSPLVLQLVKNREEQRAADAQKNLEERDHGLQFFTRQPKEGVDFGPVMEWVGVFFRLFWLSLLSGSFLLVWVFALKLAGY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.