Basic Information | |
---|---|
Taxon OID | 3300031481 Open in IMG/M |
Scaffold ID | Ga0314816_1037829 Open in IMG/M |
Source Dataset Name | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 629 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Pennsylvania | |||||||
Coordinates | Lat. (o) | 40.7997 | Long. (o) | -77.8629 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044018 | Metagenome / Metatranscriptome | 155 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314816_10378291 | F044018 | N/A | REETEETAMLTSISRKTQSLICMILSAVIVSGSLSLGAFAAERAERAAAHEGYSVTITQI |
⦗Top⦘ |