NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308394_1007071

Scaffold Ga0308394_1007071


Overview

Basic Information
Taxon OID3300031508 Open in IMG/M
Scaffold IDGa0308394_1007071 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4056
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002372Metagenome / Metatranscriptome566Y
F002795Metagenome / Metatranscriptome529Y
F007172Metagenome / Metatranscriptome356Y
F012676Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0308394_10070713F002795AGGAGGMATNDGLVLRGMVAAYREFVSRKDGKTYRVATVFGDLMAGETVLCQVDGYDVFVDSSYARGEMVELPARMQFLRDGSGRPVIKLYVDEGVR
Ga0308394_10070714F002372AGGGGGMPTRREDALWQIVHRKSSHLRSLLDSLDLVDVGVTYELDFYPYAIVELLRVREHAPPLVLRSVYVQANRQWEYHSEFALRVVEAALQLVHEYRADPSMGGAEGG
Ga0308394_10070715F012676AGGAGMNSIKLAAGWDGNPKSLTSPEHNWIRFLETRGIAYAAYLDEPPGWRLVVCDERRFTQLIPILQKYGVYGTYTWTYDIR
Ga0308394_10070716F007172GGAGGMTTPTALTALQRRAFAAALRAAKNNAYCRQVGGFAIVCLSDGTIDWFPTGQTPHQGGEEDRGAVILGKWRWNYRRWSRIA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.