NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308397_1005207

Scaffold Ga0308397_1005207


Overview

Basic Information
Taxon OID3300031512 Open in IMG/M
Scaffold IDGa0308397_1005207 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5161
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006252Metagenome / Metatranscriptome377Y
F008499Metagenome / Metatranscriptome332Y
F018115Metagenome / Metatranscriptome236Y
F019420Metagenome / Metatranscriptome229Y

Sequences

Protein IDFamilyRBSSequence
Ga0308397_10052071F019420AGGAGGMAIYRDVTFWRGAAGGDREATVIRARLLGMTIDPGDDDERPDKMTAFYEADGGGIIVYEVECWEADGRMTARWRRVASLEEMRRRYAAYLERLEL
Ga0308397_10052072F006252GAGMKSFDEQAAFGLPYERLIAQTAALLLYPHRLDLTLARLDAYAPLDYLLLDGEQPVAALEVKRRSVRSDTYPTTIIPQSVVDAAKRLTIPVFAAILFLDGLAVFDVLRTPSSVRWLRTRRGVLRKHREYDIKERLVKVEEVHQRQRRSA
Ga0308397_10052076F008499AGGAMTYRSKSEPRWKRKEREAVKALQATFGRVSDPSLARLLTPTGRVGHLTRFGVDGFVGDNPGFAVEVKARRKMLTKPTLDALLQTIDRAARFERIPLFVLVFGDDVPTRTENGARVDREWVMMPRRVLDELVGKERADE
Ga0308397_10052077F018115AGGAGMSDAEERFVRRYAHLPPDAPLDRHAARALLRRALADREALAEYLLNSECAPSLLGEFIFRHWNDAISDAPESAALRLTLRVMQALERIEDESNRRAAEWWFRLGLVPSARVLRRICEEVNDAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.