NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308412_1011245

Scaffold Ga0308412_1011245


Overview

Basic Information
Taxon OID3300031513 Open in IMG/M
Scaffold IDGa0308412_1011245 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4189
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006418Metagenome / Metatranscriptome373Y
F007976Metagenome / Metatranscriptome341Y
F010840Metagenome / Metatranscriptome298Y
F016404Metagenome / Metatranscriptome247N

Sequences

Protein IDFamilyRBSSequence
Ga0308412_10112453F016404N/AMTVDELLTDEARAAVLRALFMIVVNDNEPASARVAAARLFLSQFEEHPNADQSVLVIVDEAAFVKTV
Ga0308412_10112454F010840AGGAGGMNLPFSQPLDKITYGALAAATVIILTWALREFVGIDLPSEVQAALAVIFGYVVSYHIPLSEVEAKAIAQTFYRK
Ga0308412_10112456F006418AGGAGMSKRRSQPKPQPAREIVIAEGEDYRIIFDRETKDYAVEYRGEPVGWRPTEAEARRLVEALRYEDAKRA
Ga0308412_10112457F007976AGGAMSSTELARFLDVALDVQAPPYPGIHVDFGLMVASNGVMLVAKKYNNPAYLRGRGSLSPKVVKVLVALAEATYIGSIEVNGNRMTVTAQSTWYDEKAGAEVAGEYREVTLPELYCRQIPIKRMVEVLDDKALGWEVLPLSSNPKLKTLKEANAKDYVALVDSPHGGYELFRLRNIDDAHWYSVAQLRCGLRLFGKHSSLIVRRSKDGWLAFSDQLGYTFAITPFVKRD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.