NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308412_1071925

Scaffold Ga0308412_1071925


Overview

Basic Information
Taxon OID3300031513 Open in IMG/M
Scaffold IDGa0308412_1071925 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1108
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F002795Metagenome / Metatranscriptome529Y
F008135Metagenome / Metatranscriptome338Y
F059548Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0308412_10719251F002229GGAGGMVTLLTFDGVEDVDYVPSDAEVRVSLDDAGLYGMVLNGVTWMRLSSGAGWWTVICNRRVTATLAAVGWCWVADGCGARGYWSPALVCIPGEVRALCGCAEDEDGDDEE
Ga0308412_10719252F008135AGGAGGMRAMNDPRTERLLVSAGTSIARVLDARQRHAVALALEVCQYIVAALPPDDELTFGDMVRLLRWFVTGFREADDGDE
Ga0308412_10719253F002795GGAGGMATNSGLVLRGMVASYREFISRRDGKTYRVVTVFGDLMVGESVICTVDGYDVFVDTPGYARGEMVELPARLQFLRDGSGRPVIRLYVDEGVR
Ga0308412_10719254F059548AGGGGGMPTRREDALWSVVHRRASHLRALLDTLDDVDMSIAYELHYYPYAIVDLLRVREDAPPVVLRSAYVSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.