NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308390_1014000

Scaffold Ga0308390_1014000


Overview

Basic Information
Taxon OID3300031514 Open in IMG/M
Scaffold IDGa0308390_1014000 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2989
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002982Metagenome / Metatranscriptome515Y
F007976Metagenome / Metatranscriptome341Y
F031016Metagenome / Metatranscriptome183Y
F051735Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0308390_10140001F051735AGGAGMYQDVTIINGPVPKDGVADYERVRIKARPLGRPYAWDNGRAWNPYTTNGGFLLVFECEDGTIYVQEIEWEVDPYPDATPDPRTYYYYEVYNSLAEARAGWRGWLIEYALGNE
Ga0308390_10140004F007976AGGAMPSNELAHFLNVALDVQAEPYPGVHVDDGVILATDGVMLVVKKYNDPVYLRGRGSLSPKAAKVLAALAEATWIGSVAVVGNRVTATARSTRYEENVGEVAGEYCEVTLPEFYCPRAPVARMLATLTDEGRGWVNLVENPKLKTVKEANAKEYVALVEDPRSGEELFRPKSIEDAHWYSVGQLRRGLRLFGKNSRLSVRRNSSGWLAFGDQWGYTFAVTPFVKHN
Ga0308390_10140005F002982GGAGGVKIQFERHPHAICAVLTDAGECDRIITVARPSDAFDVFALDINAAAFTPLDTLFALPRVVCVEIERREGGWCVEVAYWHKGLGTLAQYEAEAVTLSEALARCVWALAG
Ga0308390_10140006F031016N/AITIWKGSRRVVLGDDIEFVEHETFIGEELGAVWEEENSRGTQTTFYRTHDGRIVAHVVRWSRWENEATYAYIHVFPSLDGVNGAAAMFWRELAQAGLIPPRTVTLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.