NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308396_1004346

Scaffold Ga0308396_1004346


Overview

Basic Information
Taxon OID3300031515 Open in IMG/M
Scaffold IDGa0308396_1004346 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5541
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000855Metagenome / Metatranscriptome859Y
F001381Metagenome / Metatranscriptome709Y
F007172Metagenome / Metatranscriptome356Y
F012676Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0308396_10043461F001381GAGMHYVIATLYVLVWLALAAAAALVLPRWALPAALVQLAVAYVMLRAVWLTVARDDDGA
Ga0308396_100434610F007172AGGAGGMTTPTALTTLQRRAFAAALRAAKNNDYCRAVGGFVIARLSDGSIDWFPLGQPPHRDGEADRNAVILGKWRWNHRRWSRIA
Ga0308396_100434611F012676AGGAGGMTSIKLAAGWDGSPMSLTHPEHGWIRFLEARGIAYAAYLDEPPGWRIVVCDERRFTQLIPILQKYGVYGTYTWTYDIR
Ga0308396_10043462F000855GAGGMDWLEDFWSKIVSWFDELSAGVHNGVIGWVNSLVEIWNGWMDALLHPAQAMPSIPALRWIVDWLGDIADYTRLMYMLVDYVAYASIVQQALLAQLAIVVVGLGFRAWLVIRRVVLVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.