NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308398_1025078

Scaffold Ga0308398_1025078


Overview

Basic Information
Taxon OID3300031516 Open in IMG/M
Scaffold IDGa0308398_1025078 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1707
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031016Metagenome / Metatranscriptome183Y
F048124Metagenome / Metatranscriptome148Y
F075805Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0308398_10250783F048124AGGAMATISIWRGCRDWVAGSDYEVVTYEDAREVGSVRFEDAGSDIQYRIIQWDEGIVVFFVERKGHYCEAKIFEYPDLEAAARDYAFILRKAGVI
Ga0308398_10250784F031016AGGAGGMTTITIWKGSRRVVLGDDIEFVEHVTFIGEELGAVWEEENSRGTQTVFYRTEGGKIVVHQVLWSRWEGEATHAYIHVFPSLEGVNGAAAMFWWELEQAGIIPRPTLTLEEVDGR
Ga0308398_10250785F075805AGGAGGMSVRVWHGWRGVHNGKDISRWEWIEFDGEPLGSLVVEIDEDRTDERVFYRLYDGRIVVAEHRYGDWEKGGVDYGVVSVYADLDDAARRGWRDDLVRIGAYDAPTLELDEWL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.