NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308389_1008695

Scaffold Ga0308389_1008695


Overview

Basic Information
Taxon OID3300031518 Open in IMG/M
Scaffold IDGa0308389_1008695 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4668
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042114Metagenome / Metatranscriptome158Y
F050068Metagenome / Metatranscriptome145N
F064749Metagenome / Metatranscriptome128N
F079733Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0308389_10086952F079733AGGAGGMRDIIICDKGKVTFANPDVWHLQNDNWFSEPRSAAQWREDCENELQRLCQSHYWIDVWSLPGDVSLPYDKRLTRVGQWCISRIDETCDDGRGVRQLVIFTYSDGRIILETPTYMRGEDDRLIKLVPGMKEYDDSWGFDDKGWLFHLEDVPRIWNDLYQRRLINEVASELLSLSMTLNWQGGMARLIIRLVNAGNYDDAMQVAACASARFEHEEWPEDNLFAVVHRKMMKVLVTNEL
Ga0308389_10086953F064749GGAMIQRADDYVLLCDGPKVALTTRSRAHLDDSFWQQFVRDRRLFLWDTDIMLNNLASGLRWFDVTRVATAHRHGDLLIRREAGAFLFDVIQDEVASTIAMCEWKDGRLCPVPIYSSLKCDVILWEHLIDYWNDVYRQAVYDVYGLYAHGWAYHTLLLVYELFDAGKYDYARETLKSAVARAKMEGDDELVAKFENLEQQLLAR
Ga0308389_10086954F050068N/AVAITDGVLEDIILGDYDPFWERALRLTADEFSRFCTDTIDENMYGLNWMTLWRNPDGKLTLFLDREECEVFAYKKGRSVFFFAEREHRMLLAHTTRGRFDIDVTDHGRALVWTRLTLNEQCRKMLGRKMWMSFPHEEYQGWIYNPGVRLIELNIRSLMEEGRWESAVELAAFACSEAKLRNDEAMFRFFHAIIERIQRFWPIDPQLLDKMAWR
Ga0308389_10086956F042114N/AMDKITRVKTLNEAFKAVQQRVPFAYQHPFWRALYQPIDSQRARFIIGSLHRYPQPNEYANATTEMAIFVAHAQPKRFEHNGWKCLHFELERKTLQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.