NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308389_1023283

Scaffold Ga0308389_1023283


Overview

Basic Information
Taxon OID3300031518 Open in IMG/M
Scaffold IDGa0308389_1023283 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2157
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043791Metagenome / Metatranscriptome155N
F049435Metagenome / Metatranscriptome146Y
F052993Metagenome / Metatranscriptome141N

Sequences

Protein IDFamilyRBSSequence
Ga0308389_10232831F049435N/AVFRCFIDSLPASRAQSEIVFHAHSKPFIIPKLALRIYLGFISEDSNPTDVENVKALMRAKKGGIMSEENQQLFTDPILIYDIYAVNTPDGVQLDGFFDLSFCVSRASELQDCFSQISKDLERIKRSLSKYASPKRDAISIVTPMPSPDQIRQSLKQSLQPIVASGALKLSATVADYICDFILHLFHRDVEGIIYEIWDVNKLVVRSSNNRYFDVFNTWDEEGVE
Ga0308389_10232833F052993AGGMSSLHQFKARAFQRIARKFNLRCYAFSYRDNQWLVAIRGNIVILSPTLIPIAPDIIDIRKLGNEKDYELFLALTGLGVKQSLRYQLVATGNFVTLYPKYNHAIFARSNQHVYSTRWRRIALAHAQCLSRRIKQPPCMQIAEDVERGKLMVALNYVRLGSFYIFVNGIPIDYAYPFHEQCSPQVYFGERKMLMKDNVVPWLGRLERTQLLPLPTPPPTLEQVLDKSANLDYHDEHEQEEAYPGTD
Ga0308389_10232834F043791AGGAGMIENVLIAGLATVYFAFVFTAKRGPFDFFAKIRAATRRIPVIGYHLSCPTCLSLSSGALLFALTFTPLAFLVYIMAVAGIVLALHGMAGYWHSKDDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.