Scaffold Ga0307488_10008255

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307488_10008255

Scaffold Ga0307488_10008255

Overview

Basic Information
Taxon OID	3300031519 Open in IMG/M
Scaffold ID	Ga0307488_10008255 Open in IMG/M
Source Dataset Name	Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8499
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (69.23%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	71.3731	Long. (^o)	-156.5049	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005315	Metagenome	405	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307488_1000825513	F005315	N/A	MFIIACGDSYTQGEGLEKQTQAYPYLLSSNITNFAQSGASEYLITTQIEEAVKLKPDLIVVGHTSEYRWEVWDARNKCQQGFIVANHIMRNEKYYRNWILSEQILGNTRNIKEHKAAWHAAGMLYFSEQQLVQRLWSGAVAKQILLAQRANIPMIHHCCFPHLQPLLEELTDDYV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.