NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307488_10079579

Scaffold Ga0307488_10079579


Overview

Basic Information
Taxon OID3300031519 Open in IMG/M
Scaffold IDGa0307488_10079579 Open in IMG/M
Source Dataset NameSea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2441
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)71.3731Long. (o)-156.5049Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071133Metagenome / Metatranscriptome122N
F094928Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0307488_100795792F094928GAGGMASYAQVNSAMQGQGGQQLRTFDKTVGYYINAYVYSDIYNGSYTRGQWHYQRYEYVNASNGVYNNYIDNGIYTGNIIRQQDVIDSINSVVRRTVDLIEGRISNRTINAYYCHASCHTSCHSSRGRR
Ga0307488_100795793F094928GAGGMTMDRGDINSWIQTYGGSQLRTFDKNAGIYVNAYVNSGGGSNSYTRGQWYYHRFEYVNASNGVYNNYIDGGINSGNIIYPQDIVDTLEDLVRRTVDVIEGRMSNRTINAYYCHSSCHSSCHTSRGRR
Ga0307488_100795794F071133GAGGMSMQKSYCKQMRYSGPESLAPSDATKFDVLIQMEVLAGCNHGCLGCFVDKNIDPAMNQMIIDRAKELTDGIKRTGLNLREFVIGPTDFFTATNTESVLNNSVVQEIMREHTGARIAAPAKFDLATMDKVKEIFAVLDDEDKYRREMIIEFIMPIGRVEQMLNDDEYFNSVMEKVEFFKNDTPKQMDWSWTLQA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.