NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307488_10256072

Scaffold Ga0307488_10256072


Overview

Basic Information
Taxon OID3300031519 Open in IMG/M
Scaffold IDGa0307488_10256072 Open in IMG/M
Source Dataset NameSea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1151
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)71.3731Long. (o)-156.5049Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008882Metagenome / Metatranscriptome326N

Sequences

Protein IDFamilyRBSSequence
Ga0307488_102560726F008882GAGGMSVTKYNFSKPKINRQELELLNWFLAHTNDNPLINAEALEMFKAHGFSAMNYQDLVNKIKTILKTYKTKGERRX
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.