NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318534_10180208

Scaffold Ga0318534_10180208


Overview

Basic Information
Taxon OID3300031544 Open in IMG/M
Scaffold IDGa0318534_10180208 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1221
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007041Metagenome / Metatranscriptome359Y
F046276Metagenome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0318534_101802081F046276N/ADNSLSTTMRAAPGRWSKSRTIAQCFLRLSNLAPTLLDRVGSYEARLWRQAAQTIWTLDAMRRPPASTRRPFRKPVARFYWDAEK
Ga0318534_101802082F007041AGGTGGMRGGAESAMLTRLNKVHPALKHAGYSATTLLPGEDPAAFEKLHRALIHEFAPVGTLEEEIVADMARLTWRKQNLATFRIAQLAQKRQHEINAEKVPTLDLFADDEDYLALQEARREGYQAAKEQAQQELGDTYELIDIGEPATIKGLMDELDIKERLDSLISKCLKQLLMARGVKSLSAAPSSVPTPQISGPRKAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.