NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318541_10022120

Scaffold Ga0318541_10022120


Overview

Basic Information
Taxon OID3300031545 Open in IMG/M
Scaffold IDGa0318541_10022120 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3058
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001044Metagenome / Metatranscriptome794Y
F002177Metagenome / Metatranscriptome587Y

Sequences

Protein IDFamilyRBSSequence
Ga0318541_100221203F001044GAGGMTQIDQDLLAALYALGFDFLGGDLNGEIAEIKGDMIIKLVHPPGEELKFVVTLPGGQKMIFSVDRHQIVNLADHQQ
Ga0318541_100221205F002177GGAMQTEEFATQLTNSRGRQIKFTPERLQQIRNLVERGKSREEIAELIGATVGSLQVTCSRLGISLRRSKEMGLPRRVPLPPISGQPQQNSQSGPVEQPQATTPHEERARTDEMGLANLALRMKYRGHERTKELPLTQEMIGQLAFEAQFRNVSIGGLVGELLIAIIKRDLFQHVLLDPNSKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.