NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318538_10037779

Scaffold Ga0318538_10037779


Overview

Basic Information
Taxon OID3300031546 Open in IMG/M
Scaffold IDGa0318538_10037779 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2299
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009386Metagenome / Metatranscriptome318Y
F022254Metagenome / Metatranscriptome215Y
F033728Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0318538_100377792F022254AGGCGGMTLRPRDRRTLLSRQRAYIRLHARVDSLEDAIGHFHNVIYELHTRVSTLEKKSKPLAKDD
Ga0318538_100377794F009386AGGAGGMAPKPTAARLAYVFGMVLAVAAIILGITTRNLAAPSASLIYRPDLPLLY
Ga0318538_100377795F033728N/AMGADNQAESVPERKRLSAIAKIKQDLAWRSVTGVLREHIVLTRQQAEELVAEFERFSSQEGKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.