NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307408_100086930

Scaffold Ga0307408_100086930


Overview

Basic Information
Taxon OID3300031548 Open in IMG/M
Scaffold IDGa0307408_100086930 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2351
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026217Metagenome198Y
F050961Metagenome144N

Sequences

Protein IDFamilyRBSSequence
Ga0307408_1000869302F026217GAGGMKVDVQASASPRELLEIDAAKPENRLLEHPTWRAVLDGSLQKARLKKLLLAFYPVFAGPGRYAFAAKVSQIDPQDGKQLFLQIHESLKNPVADADAGWKKVLVALGATQRELEAEPSAEAADLVDVLREHGLRSSPVHAAVIAFMLERHLPHLWGRLADSLQKHYGVKAAMLQHLRFEAGRADKVEAWVKHLVGKYVMNADAYVMFEARRSAREALWAWTALTETA
Ga0307408_1000869303F050961GGAGGMKTTPPKGMPWSAPVLVRKEGKKLAVELPPQVAADLKAGPGDVLNFTKLPEGEIQIWVVKKGGYSSLKDMK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.