NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318528_10065875

Scaffold Ga0318528_10065875


Overview

Basic Information
Taxon OID3300031561 Open in IMG/M
Scaffold IDGa0318528_10065875 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1858
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012147Metagenome / Metatranscriptome283Y
F060715Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0318528_100658751F012147AGGMSIDELARRYIANIERQQRAQSTGRFPWIRETSERAPHFSAGTRLQPTSGGRIHCEECGLRMNGQSICSGCHASPTRLWLQFVSLGTLGVLTAYNYIFALNLLPTLAPRGHVASVWLNVSEFTWLYGWIVLGVYLPAWAYYGRKKYGYSLNAGVRVGIGFVVILLIGAVVRPIFPRMGWTWAERLGTSLDSHPGLGIVAGWAVVALALVSICCNCESRDRLLGRGKGLALLALAVLCIILALSLLTAWRCGGRVA
Ga0318528_100658752F060715GAGGMEVTFVDDHVSLTGWPAWAEAGEALRATLGDADGGANCAAEMGFSPLAASASTTKPNKTVVRSEWKRIVFTTCLNGALLGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.