NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310886_10087010

Scaffold Ga0310886_10087010


Overview

Basic Information
Taxon OID3300031562 Open in IMG/M
Scaffold IDGa0310886_10087010 Open in IMG/M
Source Dataset NameLab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1524
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095762Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0310886_100870101F095762N/AGQTQHFSFYSRGEKVDTHRVEQRVAELEKVLGQTLTHKAKYYRYATAQEVEAGTGYYATGVTFAATGDVHSTEPCHDHELVHLIAGGFGGDPGAFFQEGLAVAVGNKGEWQGKPADKVARANAANVAAMVAAFDRFEAKTAYAVAGSFVGYLIRTHGMAQVKAFFQSCGPKVDAKMAFAQAFGGSIETVAARWARSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.