NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307379_10130286

Scaffold Ga0307379_10130286


Overview

Basic Information
Taxon OID3300031565 Open in IMG/M
Scaffold IDGa0307379_10130286 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - UN-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2674
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002009Metagenome / Metatranscriptome604Y
F039993Metagenome / Metatranscriptome162Y
F082339Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0307379_101302861F082339N/AQMYYEIEQGEGGQFSEMPEWLQDKIRASKEFANLKPKSTATADEDGEVVPF
Ga0307379_101302863F002009GGAMTAPTIAEMGDAAADIVWRIMGRGSEKSAYGDWLEKDRPTHDYHIARAIRHLATAQMQLHKSTPCPDNNGETATDHLERALVRCLFTLAQIKKEVPRL
Ga0307379_101302865F039993N/AMKLALSWLLYHLGDITSLTIMRWGYGYGFYNKVMLLSSDLDKHGKIWKDIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.