NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310915_10014699

Scaffold Ga0310915_10014699


Overview

Basic Information
Taxon OID3300031573 Open in IMG/M
Scaffold IDGa0310915_10014699 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4635
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003512Metagenome / Metatranscriptome482Y
F024260Metagenome / Metatranscriptome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0310915_100146995F003512N/AMPNQLATPFSGPQPWEAPDPLPVMRRELKLLLIEINVLRVEVQQLRAMEQEARKTEEFLSASVKRVMASRDHWRREAERLHALIAQVPPWSLFWWHCVDALKAWRKPADRALHCAPSET
Ga0310915_100146997F024260GGAGGMLEIRGGFRVLRQQSESADNRSNTAGQNGAIVNQAVHPSSAGERDGAETPATKTTRRAKKHWLDYATAFLTLAAAGGAITAAVFTGWQATTADQGLRDSNRAYVHSTNFRFVHYGAKNENGRTQWSVSPLIENTGSTGTRGMLMNTIISSAGEPDFASLEKAGFSPALILPKSDMTGAVFSMDGRGLDLLRGGGLIAMGIIKYADIFGDLHLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.