NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310915_10205894

Scaffold Ga0310915_10205894


Overview

Basic Information
Taxon OID3300031573 Open in IMG/M
Scaffold IDGa0310915_10205894 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1376
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000427Metagenome / Metatranscriptome1151Y
F004510Metagenome / Metatranscriptome435Y
F009509Metagenome / Metatranscriptome316Y

Sequences

Protein IDFamilyRBSSequence
Ga0310915_102058941F004510GGAGGMITWALIGSAVIALVLVVLAQGKWTSLDSWFVAVFASAVMAMVIDHYVNQIN
Ga0310915_102058942F000427AGGMTMTNASQSVKGRRVKYTPQVIEKIKEFVAEGISRDEIANRLGVTVGSLQVTCSRLGISLRRIIFPSCSRRHTADVRPGSVGIAHVREQKRVSQPEACAAPVGKFEIVMRHQDKEHTADIPLSSATIEVLALEATWRDLAIAELIGQSLVAAINKDMIHKMLGD
Ga0310915_102058943F009509N/ARGLFRLWIVGTVLFVLAVAFICYSEIKSHAEVPWPKLEMCATIAFGIPLVVLILGWAFLGSAAKQP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.