Scaffold Ga0247727_10004386

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247727_10004386

Scaffold Ga0247727_10004386

Overview

Basic Information
Taxon OID	3300031576 Open in IMG/M
Scaffold ID	Ga0247727_10004386 Open in IMG/M
Source Dataset Name	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	29966
Total Scaffold Genes	45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (68.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Virginia
Coordinates	Lat. (^o)	38.1667	Long. (^o)	-79.633	Alt. (m)		Depth (m)	9
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006193	Metagenome	379	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247727_1000438634	F006193	AGGAG	MPDTILDGSGEQTPGRRLLDGTDLEIAYNLLGDDLVVRVNKAGVQVFGVVLENAGKAMTAQQLLELKTEKSDLVVTIGTRADTVADMGYRLGRVANKLIKATREKINKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.