NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247727_10004748

Scaffold Ga0247727_10004748


Overview

Basic Information
Taxon OID3300031576 Open in IMG/M
Scaffold IDGa0247727_10004748 Open in IMG/M
Source Dataset NameBiofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28452
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (58.06%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Virginia
CoordinatesLat. (o)38.1667Long. (o)-79.633Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056988Metagenome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0247727_1000474831F056988N/APAAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGQA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.