NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307376_10002471

Scaffold Ga0307376_10002471


Overview

Basic Information
Taxon OID3300031578 Open in IMG/M
Scaffold IDGa0307376_10002471 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - TR-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18148
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007838Metagenome / Metatranscriptome344Y
F014212Metagenome265Y

Sequences

Protein IDFamilyRBSSequence
Ga0307376_100024714F014212N/AMKIRLMLAFLIISVSAGAQLIHVEGSKALGINYAYVRNGFNVSSRITFYKRGNRAYRASLDYERVSFDLSKASIAYANPELMYTFYALGDKVFFNVNGGILTGVEFISNSVLDKKKSQFFIGENIGICAEYFISNKIMLNLDFDQRFFQLSKVGDASFIIKFGVNYNF
Ga0307376_100024719F007838N/AMLKMRTLYVFLLLILNYEIFGQIPAGLTMVVKNPTWQAEDAAKESLEKADRIRQITTLTEQVNTQKESLQAIRDATEKLRKINRKVANYHNLELAIVQVSDSYTRVLNSLKTISDHNCFKPSEYHMISESMMGLLSQTSYAITTLTVVLTDNFSEMSDGERLLNMNQAIKELRENLGVINSAIIEVEILDNQRMQLRTLNYINSIFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.