Basic Information | |
---|---|
Taxon OID | 3300031579 Open in IMG/M |
Scaffold ID | Ga0308134_1066262 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 824 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 74.0136 | Long. (o) | -139.5971 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019143 | Metatranscriptome | 231 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308134_10662621 | F019143 | N/A | AAANPFRGVITLKDISEARCEGDECPGGCCPEVDFVCCDSGYFCAATQADCPEGPEVVEKEIKQDCDGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKANIGEKLIAMAAPKKIVKQDCEGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKTNIAEKLISMAAPKKVVKQDCDGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKTNIAEKLISMAAPKKVVKQDCDGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKTNIAEKLISMAAP |
⦗Top⦘ |